PDB entry 2dga

View 2dga on RCSB PDB site
Description: Crystal structure of hexameric beta-glucosidase in wheat
Class: hydrolase
Keywords: alpha/beta barrel, HYDROLASE
Deposited on 2006-03-10, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Triticum aestivum [TaxId:4565]
    Gene: Taglu1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2dgaa_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dgaA (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamagtpskpaepigpvf
    tklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisdmtng
    dvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklinslidn
    divpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfnephty
    ccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynmhgds
    kigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrlpmft
    keeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndigpit
    gtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldylqrh
    isavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksakwfsk
    fnsvpkpllkttnnnatmtaasvsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dgaA (A:)
    gpvftklkpwqipkrdwfdkdflfgastsayqiegawnedgkgpstwdhfchtyperisd
    mtngdvaansyhlyeedvkalkdmgmkvyrfsiswsrilpdgtgkvnqagidyynklins
    lidndivpyvtiwhwdtpqaledkyggflnrqivddykqfaevcfknfgdrvknwftfne
    phtyccfsygegihapgrcspgmdcavpegdslrepytaghhillahaeavqlfkarynm
    hgdskigmafdvmgyepyqdsflddqarersidynmgwflepvvrgdypfsmrsligdrl
    pmftkeeqeklasscdimglnyytsrfskhvdmspdftptlntddayassettgsdgndi
    gpitgtywiymypkgltdlllimkekygnppvfitengiadvegdesmpdplddwkrldy
    lqrhisavkdaidqgadvrghftwglidnfewslgyssrfglvyidkndgnkrklkksak
    wfskfnsvpkp