PDB entry 2dfl

View 2dfl on RCSB PDB site
Description: Crystal structure of left-handed RadA filament
Class: recombination
Keywords: archaea, filament, left-handed, DNA binding, recombination, molecular switch, reca, rad51, dmc1
Deposited on 2006-03-02, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.217
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfla1, d2dfla2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dflA (A:)
    msneveqkkniktindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqk
    iikeardaldirfktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgk
    tqlchqlsvnvqlppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyir
    aintdhqiaivddlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhql
    trlaevydiaviitnqvmarpdmfygdptvavgghtlyhvpgiriqlkksrgnrriarvv
    daphlpegevvfalteegirdaee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dflA (A:)
    tindlpgisqtvinklieagyssletlavaspqdlsvaagiplstaqkiikeardaldir
    fktalevkkermnvkkistgsqaldgllaggietrtmteffgefgsgktqlchqlsvnvq
    lppekgglsgkavyidtegtfrwerienmakalgldidnvmnniyyiraintdhqiaivd
    dlqelvskdpsiklivvdsvtshfraeypgrenlavrqqklnkhlhqltrlaevydiavi
    itnqvmhtlyhvpgiriqlkksrgnrriarvvdaphlpegevvfalteegirda