PDB entry 2dfk

View 2dfk on RCSB PDB site
Description: Crystal structure of the CDC42-Collybistin II complex
Class: cell cycle
Keywords: DH domain, PH domain, CELL CYCLE
Deposited on 2006-03-02, released 2006-05-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collybistin II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2dfka1, d2dfka2
  • Chain 'B':
    Compound: cell division cycle 42 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2dfkb_
  • Chain 'C':
    Compound: collybistin II
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cell division cycle 42 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (3-193)
      • cloning artifact (0-2)
    Domains in SCOPe 2.01: d2dfkd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dfkA (A:)
    mlwvnqedgveegpsdvqnghldpnsdclclgrplqnrdqmranvineimsterhyikhl
    kdicegylkqcrkrrdmfsdeqlkvifgniediyrfqmgfvrdlekqynnddphlseigp
    cflehqdgfwiyseycnnhldacmelsklmkdsryqhffeacrllqqmidiaidgflltp
    vqkickyplqlaellkytaqdhsdyryvaaalavmrnvtqqinerkrrlenidkiaqwqa
    svldwegddildrsseliytgemawiyqpygrnqqrvfflfdhqmvlckkdlirrdilyy
    kgridmdkyevidiedgrdddfnvsmknafklhnketeevhlffakkleekirwlrafre
    erkmvqedekigfeisenqkrqaamtvrkaskqkvtqrkwhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfkA (A:)
    clclgrplqnrdqmranvineimsterhyikhlkdicegylkqcrkrrdmfsdeqlkvif
    gniediyrfqmgfvrdlekqynnddphlseigpcflehqdgfwiyseycnnhldacmels
    klmkdsryqhffeacrllqqmidiaidgflltpvqkickyplqlaellkytaqdhsdyry
    vaaalavmrnvtqqinerkrrlenidkiaqwqasvldwegddildrsseliytgemawiy
    qpygrnqqrvfflfdhqmvlckkdlirrdilyykgridmdkyevidiedgrdddfnvsmk
    nafklhnketeevhlffakkleekirwlrafreerkmvqedekigfeisenqkrqaamtv
    rkask
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dfkB (B:)
    gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
    tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
    dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    eppepkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfkB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepk
    srrcvll
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dfkD (D:)
    gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
    tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
    dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    eppepkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfkD (D:)
    gshmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfd
    tagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqi
    dlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    epsrrcvll