PDB entry 2dfc

View 2dfc on RCSB PDB site
Description: Xylanase II from Tricoderma reesei at 293K
Class: hydrolase
Keywords: bent beta sheet, HYDROLASE
Deposited on 2006-02-28, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.106
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-189)
      • modified residue (0)
    Domains in SCOPe 2.07: d2dfca_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dfcA (A:)
    etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
    nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
    qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
    ssgsasitvs