PDB entry 2dfa

View 2dfa on RCSB PDB site
Description: Crystal Structure of Lactam Utilization Protein from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: lactam utilization protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-02-28, released 2006-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0271 protein TTHB195
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dfaa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dfaA (A:)
    mkvdlnadagesygafayghdreifplvssanlacgfhggspgrileavrlakahgvavg
    ahpgfpdlvgfgrremalspeevyadvlyqigalsaflkaeglplhhvkphgalylkacr
    dretaraialavkafdpglplvvlpgtvyeeearkaglrvvleafperaylrsgqlaprs
    mpgswitdpeeaarralrmvlegkvealdggevavradtlcihgdnpnapevaravreal
    eqagvevraf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dfaA (A:)
    mkvdlnadagesygafayghdreifplvssanlacgfhggspgrileavrlakahgvavg
    ahpgfpdlvgfgrremalspeevyadvlyqigalsaflkaeglplhhvkphgalylkacr
    dretaraialavkafdpglplvvlpgtvyeeearkaglrvvleafperaylrsgqlaprs
    mpgswitdpeeaarralrmvlegkvealdggevavradtlcihpnapevaravrealeqa
    gvevraf