PDB entry 2dey

View 2dey on RCSB PDB site
Description: Crystal structure of human peptidylarginine deiminase 4 in complex with histone H4 N-terminal tail including Arg3
Class: hydrolase
Keywords: histone modification enzyme, HYDROLASE
Deposited on 2006-02-18, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10-mer peptide from histone H4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2DEY
  • Chain 'X':
    Compound: Protein-arginine deiminase type IV
    Species: Homo sapiens [TaxId:9606]
    Gene: PADI4, PADI5, PDI5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UM07 (Start-670)
      • engineered (652)
    Domains in SCOPe 2.07: d2deyx1, d2deyx2, d2deyx3
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2deyX (X:)
    gplgspefmaqgtlirvtpeqpthavcvlgtltqldicssapedctsfsinaspgvvvdi
    ahsppakkkstgsstwpldpgvevtltmkaasgstgdqkvqisyygpktppvkallylta
    veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
    dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
    wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
    vapwimtpntqppqevyacsifenedflksvttlamkakcklticpeeenmddqwmqdem
    eigyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrgpqtggisgldsfgnlev
    sppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqqvqapvklysdwlsvghv
    deflsfvpapdrkgfrlllasprscyklfqeqqneghgeallfegikkkkqqkiknilsn
    ktlrehnsfvercidwnrellkrelglaesdiidipqlfklkefskaeaffpnmvnmlvl
    gkhlgipkpfgpvingrccleekvcslleplglqctfindfftyhirhgevhagtnvrrk
    pfsfkwwnmvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2deyX (X:)
    gtlirvtpeqpthavcvlgtltqldicssapctsfsinaspgvvvditwpldpgvevtlt
    mkaasgstgdqkvqisyygpktppvkallyltaveislcaditrtgkqrtwtwgpcgqga
    illvncdrdnlessamdceddevldsedlqdmslmtlstktpkdfftnhtlvlhvarsem
    dkvrvfqatcsvvlgpkwpshylmvpggkhnmdfyvealafpdtdfpglitltislldts
    nlelpeavvfqdsvvfrvapwimtpntqppqevyacsifenedflksvttlamkakcklt
    icpeeenmddqwmqdemeigyiqaphktlpvvfdsprnrglkefpikrvmgpdfgyvtrg
    pqtggisgldsfgnlevsppvtvrgkeyplgrilfgdscypsndsrqmhqalqdflsaqq
    vqapvklysdwlsvghvdeflsfvpapdrkgfrlllasprscyklfqeqqneghgeallf
    egikkkkqqkiknilsnktlrehnsfvercidwnrellkrelglaesdiidipqlfklke
    fskaeaffpnmvnmlvlgkhlgipkpfgpvingrccleekvcslleplglqctfindfft
    yhirhgevhagtnvrrkpfsfkwwnmvp