PDB entry 2deg

View 2deg on RCSB PDB site
Description: Crystal structure of tt0972 protein form Thermus Thermophilus with Mn2(+) ions
Class: structural genomics, unknown function
Keywords: dodecamer, flavin, manganese ion, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-02-10, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.238
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254 (Start-68)
    Domains in SCOPe 2.08: d2dega_
  • Chain 'B':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254 (Start-68)
    Domains in SCOPe 2.08: d2degb_
  • Chain 'C':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254
    Domains in SCOPe 2.08: d2degc_
  • Chain 'D':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254
    Domains in SCOPe 2.08: d2degd_
  • Chain 'E':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254
    Domains in SCOPe 2.08: d2dege_
  • Chain 'F':
    Compound: tt0972 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD71254
    Domains in SCOPe 2.08: d2degf_
  • Heterogens: NA, MN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2degA (A:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degA (A:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2degB (B:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degB (B:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrleet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2degC (C:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degC (C:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrlee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2degD (D:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degD (D:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrlee
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2degE (E:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degE (E:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrlee
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2degF (F:)
    mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvl
    evgfrleet
    

    Sequence, based on observed residues (ATOM records): (download)
    >2degF (F:)
    gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
    vgfrlee