PDB entry 2deb

View 2deb on RCSB PDB site
Description: Crystal structure of rat carnitine palmitoyltransferase 2 in space group C2221
Class: transferase
Keywords: central six-stranded beta-sheet, TRANSFERASE
Deposited on 2006-02-10, released 2007-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carnitine O-palmitoyltransferase II, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18886 (Start-652)
      • modified residue (37)
      • modified residue (55)
      • modified residue (113)
      • modified residue (129)
      • modified residue (208)
      • modified residue (326)
      • modified residue (336)
      • modified residue (467)
      • modified residue (525-526)
      • modified residue (542)
      • modified residue (576)
    Domains in SCOPe 2.08: d2deba1
  • Chain 'B':
    Compound: Carnitine O-palmitoyltransferase II, mitochondrial
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18886
      • modified residue (37)
      • modified residue (55)
      • modified residue (113)
      • modified residue (129)
      • modified residue (208)
      • modified residue (326)
      • modified residue (336)
      • modified residue (467)
      • modified residue (525-526)
      • modified residue (542)
      • modified residue (576)
    Domains in SCOPe 2.08: d2debb1
  • Heterogens: COA, PLM, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2debA (A:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2debA (A:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkaikt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2debB (B:)
    mgsshhhhhhssglvprgshmavsgpddylqhsivptmhyqdslprlpipkledtmkryl
    naqkpllddsqfrrtealcknfetgvgkelhahllaqdkqnkhtsyisgpwfdmyltard
    sivlnfnpfmafnpdpkseyndqltratnltvsavrflktlqagllepevfhlnpsksdt
    dafkrlirfvppslswygaylvnaypldmsqyfrlfnstriprpnrdelftdtkarhllv
    lrkghfyvfdvldqdgnivnpleiqahlkyilsdsspvpefpvayltsenrdvwaelrqk
    lifdgneetlkkvdsavfclclddfpmkdlihlshtmlhgdgtnrwfdksfnlivaedgt
    aavhfehswgdgvavlrffnevfrdstqtpaitpqsqpaatnssasvetlsfnlsgalka
    gitaakekfdttvktlsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvat
    yescstaafkhgrtetirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltke
    aamgqgfdrhlyalrylatarglnlpelyldpayqqmnhnilststlnspavslggfapv
    vpdgfgiayavhddwigcnvssysgrnareflhcvqkcledifdalegkaikt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2debB (B:)
    ddylqhsivptmhyqdslprlpipkledtmkrylnaqkpllddsqfrrtealcknfetgv
    gkelhahllaqdkqnkhtsyisgpwfdmyltardsivlnfnpfmafnpdpkseyndqltr
    atnltvsavrflktlqagllepevfhlnpsksdtdafkrlirfvppslswygaylvnayp
    ldmsqyfrlfnstriprpnrdelftdtkarhllvlrkghfyvfdvldqdgnivnpleiqa
    hlkyilsdsspvpefpvayltsenrdvwaelrqklifdgneetlkkvdsavfclclddfp
    mkdlihlshtmlhgdgtnrwfdksfnlivaedgtaavhfehswgdgvavlrffnevfrds
    tqtpaitpqsqpaatnssasvetlsfnlsgalkagitaakekfdttvktlsidsiqfqrg
    gkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrtetirpasiftkr
    cseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalrylatarglnlp
    elyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddwigcnvssysgr
    nareflhcvqkcledifdalegkaik