PDB entry 2de8

View 2de8 on RCSB PDB site
Description: Crystal structure of porcine pancreatic elastase with a unique conformation induced by Tris
Class: hydrolase
Keywords: native strucure, serine protease, HYDROLASE
Deposited on 2006-02-09, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.223
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2de8a_
  • Heterogens: CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2de8A (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn