PDB entry 2de7

View 2de7 on RCSB PDB site
Description: The substrate-bound complex between oxygenase and ferredoxin in carbazole 1,9a-dioxygenase
Class: oxidoreductase
Keywords: Electron transfer complex, Rieske non-heme iron oxygenase system, Terminal oxygenase, Rieske-type ferredoxin, carbazole 1,9a-dioxygenase, OXIDOREDUCTASE
Deposited on 2006-02-08, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: terminal oxygenase component of carbazole
    Species: Janthinobacterium [TaxId:29580]
    Database cross-references and differences (RAF-indexed):
    • GB BAC56742 (0-383)
      • expression tag (384-388)
    Domains in SCOPe 2.06: d2de7a1, d2de7a2, d2de7a3
  • Chain 'B':
    Compound: terminal oxygenase component of carbazole
    Species: Janthinobacterium [TaxId:29580]
    Database cross-references and differences (RAF-indexed):
    • GB BAC56742 (0-383)
      • expression tag (384-387)
    Domains in SCOPe 2.06: d2de7b1, d2de7b2, d2de7b3
  • Chain 'C':
    Compound: terminal oxygenase component of carbazole
    Species: Janthinobacterium [TaxId:29580]
    Database cross-references and differences (RAF-indexed):
    • GB BAC56742 (0-383)
      • expression tag (384-388)
    Domains in SCOPe 2.06: d2de7c1, d2de7c2, d2de7c3
  • Chain 'D':
    Compound: ferredoxin component of carbazole
    Species: Pseudomonas resinovorans [TaxId:53412]
    Database cross-references and differences (RAF-indexed):
    • GB NP_758571 (Start-106)
      • expression tag (107)
  • Chain 'E':
    Compound: ferredoxin component of carbazole
    Species: Pseudomonas resinovorans [TaxId:53412]
    Database cross-references and differences (RAF-indexed):
    • GB NP_758571 (Start-106)
      • expression tag (107-108)
  • Chain 'F':
    Compound: ferredoxin component of carbazole
    Species: Pseudomonas resinovorans [TaxId:53412]
    Database cross-references and differences (RAF-indexed):
    • GB NP_758571 (Start-106)
  • Heterogens: FE2, FES, 9CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2de7A (A:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2de7A (A:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2de7B (B:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2de7B (B:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2de7C (C:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2de7C (C:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhh
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.