PDB entry 2ddz

View 2ddz on RCSB PDB site
Description: Protein of Unknown Function from Pyrococcus horikoshi
Class: structural genomics, unknown function
Keywords: Hexamer, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-02-07, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (Start-189)
    Domains in SCOPe 2.07: d2ddza1
  • Chain 'B':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (Start-189)
    Domains in SCOPe 2.07: d2ddzb_
  • Chain 'C':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (Start-189)
    Domains in SCOPe 2.07: d2ddzc_
  • Chain 'D':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (Start-189)
    Domains in SCOPe 2.07: d2ddzd_
  • Chain 'E':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (0-189)
    Domains in SCOPe 2.07: d2ddze_
  • Chain 'F':
    Compound: 190aa long hypothetical protein
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB BAA29295 (Start-189)
    Domains in SCOPe 2.07: d2ddzf_
  • Heterogens: GAI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddzA (A:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddzA (A:)
    smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
    ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
    siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
    slkvrwvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ddzB (B:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddzB (B:)
    smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
    ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
    siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
    slkvrwvt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ddzC (C:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddzC (C:)
    smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
    ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
    siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
    slkvrwvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ddzD (D:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddzD (D:)
    smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
    ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
    siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
    slkvrwvt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ddzE (E:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ddzF (F:)
    mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlr
    keikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrkl
    sisiatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvr
    kdslkvrwvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddzF (F:)
    smelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrke
    ikgddmvhyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsi
    siatvspvsikihiglnvktvgvppgvdaigleelgidptefmersakalveeiekvrkd
    slkvrwvt