PDB entry 2ddt

View 2ddt on RCSB PDB site
Description: Crystal structure of sphingomyelinase from Bacillus cereus with magnesium ion
Class: hydrolase
Keywords: DNase I like folding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2006-02-02, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ddta_
  • Chain 'B':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ddtb_
  • Heterogens: MG, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddtA (A:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddtA (A:)
    dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
    kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcnlsn
    kgfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdmn
    vnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiia
    skdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ddtB (B:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddtB (B:)
    dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
    kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgclsnk
    gfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdmnv
    nkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiias
    kdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism