PDB entry 2ddh

View 2ddh on RCSB PDB site
Description: Crystal Structure of Acyl-CoA oxidase complexed with 3-OH-dodecanoate
Class: oxidoreductase
Keywords: BETA BARREL, ALPHA up-down BUNDLE
Deposited on 2006-01-29, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA oxidase
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ddha1, d2ddha2, d2ddha3
  • Heterogens: FAD, HXD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddhA (A:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllhqataeqq
    erffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpggl
    gktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngyl
    kmdnyriprenmlmkyaqvkpdgtyvkplsnkltygtmvfvrsflvgnaaqslskactia
    irysavrrqseikqsepepqildfqtqqyklfpllatayafhfvgrymketylrinesig
    qgdlselpelhaltaglkafttwtanagieecrmacgghgyshssgipniyvtftpactf
    egentvmmlqtarflmkiydqvrsgklvggmvsylndlpsqriqpqqvavwptmvdinsl
    eglteayklraarlveiaaknlqthvshrkskevawnltsvdlvraseahchyvvvkvfs
    dklpkiqdkavqavlrnlcllyslygisqkggdflegsiitgaqlsqvnarilelltlir
    pnavalvdafdfkdmtlgsvlgrydgnvyenlfewakksplnktevhesyhkhlkplqsk
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddhA (A:)
    mnpdlrkerasatfnpelithildgspentrrrreienlilndpdfqhedynfltrsqry
    evavkksatmvkkmreygisdpeeimwfknsvhrghpepldlhlgmflptllqataeqqe
    rffmpawnleitgtyaqtemghgthlrglettatydpktqefilnsptvtsikwwpgglg
    ktsnhaivlaqlitqgecyglhafvvpireigthkplpgitvgdigpkfgyeemdngylk
    mdnyriprenmlmkyaqvkpdgtyvkplmvfvrsflvgnaaqslskactiairysavrrq
    seikqsepepqildfqtqqyklfpllatayafhfvgrymketylrselpelhaltaglka
    fttwtanagieecrmacgghgyshssgipniyvtftpactfegentvmmlqtarflmkiy
    dqvrsgklvggmvsylndlpsvdinsleglteayklraarlveiaaknlqthvshrkske
    vawnltsvdlvraseahchyvvvkvfsdklpkiqdkavqavlrnlcllyslygisqkggd
    flegsiitgaqlsqvnarilelltlirpnavalvdafdfkdmtlgsvlgrydgnvyenlf
    ewakksplnktevhesyhkhlk