PDB entry 2ddc

View 2ddc on RCSB PDB site
Description: Unique behavior of a histidine responsible for an engineered green-to-red photoconversion process
Class: luminescent protein
Keywords: photoconversion, red state, LUMINESCENT PROTEIN
Deposited on 2006-01-27, released 2006-03-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.19
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photoconvertible fluorescent protein
    Species: Favia favus [TaxId:102203]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG8 (0-End)
      • engineered (0)
      • engineered (11)
      • chromophore (63)
      • engineered (69)
      • engineered (143)
      • engineered (196)
    Domains in SCOPe 2.03: d2ddca_
  • Chain 'B':
    Compound: photoconvertible fluorescent protein
    Species: Favia favus [TaxId:102203]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG8 (0-226)
      • engineered (0)
      • engineered (11)
      • chromophore (63)
      • engineered (69)
      • engineered (143)
      • engineered (196)
    Domains in SCOPe 2.03: d2ddcb_
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddcA (A:)
    vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
    fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
    irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddcA (A:)
    vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
    fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
    irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ddcB (B:)
    vsvitsemkievrmegavnghkfvitgkgsgqpfegiqnvdltvieggplpfafdiltta
    fhygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvne
    irfdgvnfpangpvmqrktvkwesstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhlmeitshdkdynkvklyehakahsglprlak