PDB entry 2dd9

View 2dd9 on RCSB PDB site
Description: A mutant of GFP-like protein from Chiridius poppei
Class: luminescent protein
Keywords: gfp-like protein, fluorescent protein, luminescent protein
Deposited on 2006-01-24, released 2007-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Chiridius poppei [TaxId:286301]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2MHN7 (0-End)
      • engineered (50)
      • chromophore (54)
    Domains in SCOPe 2.03: d2dd9a_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Chiridius poppei [TaxId:286301]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2MHN7 (0-End)
      • engineered (50)
      • chromophore (54)
    Domains in SCOPe 2.03: d2dd9b_
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Chiridius poppei [TaxId:286301]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2MHN7 (0-End)
      • engineered (50)
      • chromophore (54)
    Domains in SCOPe 2.03: d2dd9c_
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Chiridius poppei [TaxId:286301]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2MHN7 (0-End)
      • engineered (50)
      • chromophore (54)
    Domains in SCOPe 2.03: d2dd9d_
  • Heterogens: CXS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dd9A (A:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd9A (A:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dd9B (B:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd9B (B:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dd9C (C:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd9C (C:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsapr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dd9D (D:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dd9D (D:)
    ttfkiesrihgnlngekfelvgggvgeegrleiemktkdkplafspfllstcmgygfyhf
    asfpkgtkniylhaatnggytntrkeiyedggilevnfrytyefnkiigdvecighgfps
    qspifkdtivkscptvdlmlpmsgniiassyarafqlkdgsfytaevknnidfknpihes
    fsksgpmfthrrveethtkenlamveyqqvfnsaprd