PDB entry 2dd8

View 2dd8 on RCSB PDB site
Description: Crystal Structure of SARS-CoV Spike Receptor-Binding Domain Complexed with Neutralizing Antibody
Class: immune system/viral protein
Keywords: SARS, S protein, antibody, crystal structure, epitopes, vaccines, inhibitors
Deposited on 2006-01-24, released 2006-04-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: IGG Heavy chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: IGG Light chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Spike glycoprotein
    Species: Human SARS coronavirus
    Gene: Tor2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dd8s1
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'S':
    Sequence, based on SEQRES records: (download) 
    >2dd8S (S:)
pnitnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnd
lcfsnvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgny
nykyrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrv
vvlsfellnapatvcgpklstd

    Sequence, based on observed residues (ATOM records): (download) 
    >2dd8S (S:)
nlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfs
nvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyky
rylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvls
fellnapatvcg