PDB entry 2dct
View 2dct on RCSB PDB site
Description: Crystal structure of the TT1209 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, Thermus thermophilus HB8, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on
2006-01-12, released
2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.199
AEROSPACI score: 0.62
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hypothetical protein TTHA0104
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2dcta1 - Chain 'B':
Compound: hypothetical protein TTHA0104
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2dctb_ - Heterogens: NA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2dctA (A:)
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2dctB (B:)
meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegev
vvrvgeeeallapgmaafapagaphgvrnesaspalllvvtaprp