PDB entry 2dcn

View 2dcn on RCSB PDB site
Description: Crystal structure of 2-keto-3-deoxygluconate kinase from Sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
Class: transferase
Keywords: 2-keto-3-deoxygluconate kinase, sulfolobus tokodaii, 2-keto-D-gluconate, TRANSFERASE
Deposited on 2006-01-10, released 2006-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcna1
  • Chain 'B':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnb_
  • Chain 'C':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnc_
  • Chain 'D':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnd_
  • Chain 'E':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcne_
  • Chain 'F':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnf_
  • Chain 'G':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcng_
  • Chain 'H':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnh_
  • Chain 'I':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcni_
  • Chain 'J':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnj_
  • Chain 'K':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnk_
  • Chain 'L':
    Compound: hypothetical fructokinase
    Species: Sulfolobus tokodaii [TaxId:273063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dcnl_
  • Heterogens: MG, K, CKP, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dcnA (A:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnA (A:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dcnB (B:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnB (B:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dcnC (C:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnC (C:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dcnD (D:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnD (D:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2dcnE (E:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnE (E:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2dcnF (F:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnF (F:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2dcnG (G:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnG (G:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dcnH (H:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnH (H:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2dcnI (I:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnI (I:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2dcnJ (J:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnJ (J:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2dcnK (K:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnK (K:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2dcnL (L:)
    maklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgdde
    fgynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklsped
    vdeeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreil
    kllskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyy
    ssgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttk
    dietflremkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dcnL (L:)
    aklitlgeiliefnalspgplrhvsyfekhvagseanycvafikqgnecgiiakvgddef
    gynaiewlrgqgvdvshmkidpsaptgiffiqrhypvplksesiyyrkgsagsklspedv
    deeyvksadlvhssgitlaisstakeavykafeiasnrsfdtnirlklwsaeeakreilk
    llskfhlkflitdtddskiilgesdpdkaakafsdyaeiivmklgpkgaivyydgkkyys
    sgyqvpvedvtgagdalggtflslyykgfemekaldyaivastlnvmirgdqenlpttkd
    ietflrem