PDB entry 2dc3

View 2dc3 on RCSB PDB site
Description: Crystal structure of human cytoglobin at 1.68 angstroms resolution
Class: oxygen storage/transport
Keywords: cytoglobin, myoglobin, heme, oxygen transport, oxygen storage, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2005-12-21, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.142
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: CYGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dc3a_
  • Chain 'B':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Gene: CYGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dc3b_
  • Heterogens: HEM, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dc3A (A:)
    gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsak
    qyfsqfkhmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkh
    kvepvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpn
    attppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dc3A (A:)
    eelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhmedplemersp
    qlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevva
    eefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnattppatlpss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dc3B (B:)
    gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsak
    qyfsqfkhmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkh
    kvepvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpn
    attppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dc3B (B:)
    vpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqf
    khmedplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvy
    fkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgw