PDB entry 2dbw

View 2dbw on RCSB PDB site
Description: Crystal Structure of Gamma-glutamyltranspeptidase from Escherichia coli Acyl-Enzyme Intermediate
Class: Transferase
Keywords: gamma-glutamyltransferase, ggt, gamma-gtp, glutathione, acyl-enzyme intermediate, Transferase
Deposited on 2005-12-16, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dbw.1
  • Chain 'B':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dbw.1
  • Chain 'C':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dbw.2
  • Chain 'D':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dbw.2
  • Heterogens: GGL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dbwA (A:)
    aappappvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyala
    vthpqagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshla
    sgtpgtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhen
    skaifwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitk
    edlaaykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamq
    imaeaekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgkla
    pyesnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dbwA (A:)
    appvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthp
    qagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtp
    gtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskai
    fwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedla
    aykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimae
    aekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbwB (B:)
    tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgvpnvyglvggd
    anavgpnkrplssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatn
    aprfhhqwlpdelrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdp
    rsvddltagy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dbwC (C:)
    aappappvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyala
    vthpqagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshla
    sgtpgtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhen
    skaifwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitk
    edlaaykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamq
    imaeaekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgkla
    pyesnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dbwC (C:)
    vsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthpqag
    nlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtpgtv
    agfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskaifwk
    egeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedlaayk
    avertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimaeaek
    yayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbwD (D:)
    tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgvpnvyglvggd
    anavgpnkrplssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatn
    aprfhhqwlpdelrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdp
    rsvddltagy