PDB entry 2dbu

View 2dbu on RCSB PDB site
Description: Crystal Structure of Gamma-glutamyltranspeptidase from Escherichia coli
Class: Transferase
Keywords: gamma-glutamyltransferase, ggt, gamma-gtp, glutathione
Deposited on 2005-12-16, released 2006-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.207
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18956
      • modified residue (25)
      • modified residue (74)
      • modified residue (91)
      • modified residue (100)
      • modified residue (139)
      • modified residue (208)
      • modified residue (230)
      • modified residue (265)
      • modified residue (287)
      • modified residue (298)
      • modified residue (301)
    Domains in SCOPe 2.08: d2dbu.1
  • Chain 'B':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18956 (0-189)
      • modified residue (40)
      • modified residue (73)
      • modified residue (103)
      • modified residue (159)
      • modified residue (166)
    Domains in SCOPe 2.08: d2dbu.1
  • Chain 'C':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18956
      • modified residue (25)
      • modified residue (74)
      • modified residue (91)
      • modified residue (100)
      • modified residue (139)
      • modified residue (208)
      • modified residue (230)
      • modified residue (265)
      • modified residue (287)
      • modified residue (298)
      • modified residue (301)
    Domains in SCOPe 2.08: d2dbu.2
  • Chain 'D':
    Compound: Gamma-glutamyltranspeptidase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ggt
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18956 (0-189)
      • modified residue (40)
      • modified residue (73)
      • modified residue (103)
      • modified residue (159)
      • modified residue (166)
    Domains in SCOPe 2.08: d2dbu.2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dbuA (A:)
    aappappvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyala
    vthpqagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshla
    sgtpgtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhen
    skaifwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitk
    edlaaykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamq
    imaeaekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgkla
    pyesnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dbuA (A:)
    appvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthp
    qagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtp
    gtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskai
    fwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedla
    aykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimae
    aekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbuB (B:)
    tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgvpnvyglvggd
    anavgpnkrplssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatn
    aprfhhqwlpdelrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdp
    rsvddltagy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dbuC (C:)
    aappappvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyala
    vthpqagnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshla
    sgtpgtvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhen
    skaifwkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitk
    edlaaykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamq
    imaeaekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgkla
    pyesnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dbuC (C:)
    ppvsygveedvfhpvrakqgmvasvdatatqvgvdilkeggnavdaavavgyalavthpq
    agnlggggfmlirskngnttaidfremapakatrdmflddqgnpdskksltshlasgtpg
    tvagfslaldkygtmplnkvvqpafklardgfivndaladdlktygsevlpnhenskaif
    wkegeplkkgdtlvqanlakslemiaengpdefykgtiaeqiaqemqkngglitkedlaa
    ykavertpisgdyrgyqvysmpppssggihivqilnilenfdmkkygfgsadamqimaea
    ekyayadrseylgdpdfvkvpwqaltnkayaksiadqidinkakpsseirpgklapye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dbuD (D:)
    tthysvvdkdgnavavtytlnttfgtgivagesgillnnqmddfsakpgvpnvyglvggd
    anavgpnkrplssmsptivvkdgktwlvtgspggsriittvlqmvvnsidyglnvaeatn
    aprfhhqwlpdelrvekgfspdtlklleakgqkvalkeamgstqsimvgpdgelygasdp
    rsvddltagy