PDB entry 2dbo

View 2dbo on RCSB PDB site
Description: Crystal structure of D-Tyr-tRNA(Tyr) deacylase from Aquifex aeolicus
Class: Hydrolase
Keywords: D-amino acid, D-Tyrosine, tRNA, deacylase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Hydrolase
Deposited on 2005-12-15, released 2006-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: D-tyrosyl-tRNA(Tyr) deacylase
  Species: Aquifex aeolicus [TaxId:224324]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O66742 (0-147)
  Domains in SCOPe 2.08: d2dboa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dboA (A:)
  mraviqrvkkswvevdgkvvgsineglnvflgvrkgdteedieklvnkilnlrifederg
  kfqysvldikgeilvvsqftlyanvkkgrrpsfeeaeepkrakelyekfvdkikesglkv
  etgifgammdvfienwgpvtiiidsrei