PDB entry 2dbm

View 2dbm on RCSB PDB site
Description: Solution structures of the SH3 domain of human SH3-containing GRB2-like protein 2
Class: transferase, signaling protein
Keywords: EC 2.3.1.-, SH3 domain protein 2A, Endophilin 1, EEN-B1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE, SIGNALING PROTEIN
Deposited on 2005-12-15, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sh3-containing grb2-like protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: SH3GL2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q99962 (7-66)
    • cloning artifact (0-6)
    • cloning artifact (67-72)
  Domains in SCOPe 2.08: d2dbma1, d2dbma2, d2dbma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dbmA (A:)
  gssgssgpccralydfepenegelgfkegdiitltnqidenwyegmlhghsgffpinyve
  ilvalphsgpssg