PDB entry 2dbj

View 2dbj on RCSB PDB site
Description: Solution structures of the fn3 domain of human Proto-oncogene tyrosine-protein kinase MER precursor
Class: Transferase, SIGNALING PROTEIN
Keywords: EC 2.7.1.112, C-mer, Receptor tyrosine kinase MerTK, fn3 domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase, SIGNALING PROTEIN
Deposited on 2005-12-15, released 2006-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase MER precursor
  Species: Homo sapiens [TaxId:9606]
  Gene: MERTK
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12866 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOPe 2.07: d2dbja1, d2dbja2, d2dbja3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dbjA (A:)
  gssgssgwilasttegapsvaplnvtvflnessdnvdirwmkpptkqqdgelvgyrishv
  wqsagiskelleevgqngsrarisvqvhnatctvriaavtrggvgpfsdpvkifipahsg
  pssg