PDB entry 2db9

View 2db9 on RCSB PDB site
Description: Solution structure of the plus-3 domain of human KIAA0252 protein
Class: structural genomics, unknown function
Keywords: plus-3 domain; structural genomics, KIAA0252, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2005-12-15, released 2006-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paf1/RNA polymerase II complex component
    Species: Homo sapiens [TaxId:9606]
    Gene: RTF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92541 (7-142)
      • cloning artifact (0-6)
      • cloning artifact (143-148)
    Domains in SCOPe 2.07: d2db9a1, d2db9a2, d2db9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2db9A (A:)
    gssgssgppksqpvslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpv
    yrvaeitgvvetakvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeam
    fsagmqlptldeinkkelsikeasgpssg