PDB entry 2db7

View 2db7 on RCSB PDB site
Description: Crystal structure of hypothetical protein MS0332
Class: transcription
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, DNA BINDING PROTEIN, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-12-15, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hairy/enhancer-of-split related with YRPW motif 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5J3 (7-End)
      • cloning artifact (5-6)
      • modified residue (16)
    Domains in SCOPe 2.08: d2db7a1, d2db7a2
  • Chain 'B':
    Compound: Hairy/enhancer-of-split related with YRPW motif 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y5J3 (7-End)
      • cloning artifact (5-6)
      • modified residue (16)
    Domains in SCOPe 2.08: d2db7b2, d2db7b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2db7A (A:)
    gssgssggyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyas
    qrea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2db7A (A:)
    sggyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2db7B (B:)
    gssgssggyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyas
    qrea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2db7B (B:)
    sggyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqr