PDB entry 2dax

View 2dax on RCSB PDB site
Description: Solution structure of the RWD domain of human protein C21orf6
Class: structural genomics, unknown function
Keywords: RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein C21orf6
  Species: Homo sapiens [TaxId:9606]
  Gene: C21orf6
  Database cross-references and differences (RAF-indexed):
  • Uniprot P57060 (7-145)
    • cloning artifact (0-6)
    • cloning artifact (146-151)
  Domains in SCOPe 2.06: d2daxa1, d2daxa2, d2daxa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2daxA (A:)
  gssgssgeqaeaqlaeldllasmfpgenelivndqlavaelkdciekktmegrsskvyft
  inmnldvsdekmamfslacilpfkypavlpeitvrsvllsrsqqtqlntdltaflqkhch
  gdvcilnatewvrehasgyvsrdtsssgpssg