PDB entry 2daw

View 2daw on RCSB PDB site
Description: Solution structure of the RWD domain of human RWD omain containing protein 2
Class: structural genomics, unknown function
Keywords: RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RWD domain containing protein 2
    Species: HOMO SAPIENS
    Gene: RWDD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIY3 (7-147)
      • cloning artifact (0-6)
      • see remark 999 (89)
      • cloning artifact (148-153)
    Domains in SCOP 1.75: d2dawa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dawA (A:)
    gssgssgmsasvkeslqlqllememlfsmfpnqgevkledvnaltnikrylegtrealpp
    kiefvitlqieepkvkidlqvtmphsypylalqlfgrsseldrhqqlllnkgltsyigtf
    dpgelcvcaaiqwlqdnsasyflnrklvsgpssg