PDB entry 2dav

View 2dav on RCSB PDB site
Description: Solution structure of the first ig-like domain of Myosin-binding protein C, slow-type
Class: structural protein, contractile protein
Keywords: IG domain, Myosin-binding protein C, slow-type, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN, CONTRACTILE PROTEIN
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myosin-binding protein C, slow-type
    Species: Homo sapiens [TaxId:9606]
    Gene: MYBPC1, MYBPCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00872 (7-119)
      • cloning artifact (0-6)
      • cloning artifact (120-125)
    Domains in SCOPe 2.08: d2dava1, d2dava2, d2dava3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2davA (A:)
    gssgssgilfiekpqggtvkvgeditfiakvkaedllrkptikwfkgkwmdlaskagkhl
    qlketferhsrvytfemqiikakdnfagnyrcevtykdkfdscsfdlevhestgttpnid
    sgpssg