PDB entry 2das

View 2das on RCSB PDB site
Description: Solution structure of TRASH domain of zinc finger MYM-type protein 5
Class: metal transport
Keywords: TRASH domain, Zinc finger MYM-type protein 5, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL TRANSPORT
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger MYM-type protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ZMYM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ78 (7-55)
      • cloning artifact (0-6)
      • cloning artifact (56-61)
    Domains in SCOPe 2.07: d2dasa1, d2dasa2, d2dasa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dasA (A:)
    gssgssgqptaqqqltkpakitcanckkplqkgqtayqrkgsahlfcsttclssfssgps
    sg