PDB entry 2dar

View 2dar on RCSB PDB site
Description: Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein
Class: metal binding protein
Keywords: LIM domain, Enigma homolog protein, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-14, released 2006-12-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-12, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PDZ and LIM domain protein 5
  Species: HOMO SAPIENS
  Gene: ENH
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96HC4 (7-83)
    • cloning artifact (0-6)
    • cloning artifact (84-89)
  Domains in SCOP 1.73: d2dara1, d2dara2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2darA (A:)
  gssgssgdqdtlvqraehipagkrtpmcahcnqvirgpflvalgkswhpeefncahcknt
  mayigfveekgalycelcyekffasgpssg