PDB entry 2dar

View 2dar on RCSB PDB site
Description: Solution structure of first LIM domain of Enigma-like PDZ and LIM domains protein
Class: metal binding protein
Keywords: LIM domain, Enigma homolog protein, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-12-14, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ and LIM domain protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ENH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96HC4 (7-83)
      • cloning artifact (0-6)
      • cloning artifact (84-89)
    Domains in SCOPe 2.08: d2dara1, d2dara2, d2dara3, d2dara4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2darA (A:)
    gssgssgdqdtlvqraehipagkrtpmcahcnqvirgpflvalgkswhpeefncahcknt
    mayigfveekgalycelcyekffasgpssg