PDB entry 2daq

View 2daq on RCSB PDB site
Description: Solution structure of second PWWP domain of WHSC1L1 protein
Class: protein binding
Keywords: PWWP domain, WHSC1L1 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: WHSC1L1 protein, isoform long
  Species: HOMO SAPIENS
  Gene: WHSC1L1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BZ95 (7-103)
    • cloning artifact (0-6)
    • cloning artifact (104-109)
  Domains in SCOP 1.73: d2daqa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2daqA (A:)
  gssgssgklhykqivwvklgnyrwwpaeicnprsvplniqglkhdlgdfpvfffgshdyy
  wvhqgrvfpyvegdksfaegqtsinktfkkaleeaakrfqelkasgpssg