PDB entry 2daq

View 2daq on RCSB PDB site
Description: Solution structure of second PWWP domain of WHSC1L1 protein
Class: protein binding
Keywords: PWWP domain, WHSC1L1 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-12-14, released 2006-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WHSC1L1 protein, isoform long
    Species: Homo sapiens [TaxId:9606]
    Gene: WHSC1L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BZ95 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.08: d2daqa1, d2daqa2, d2daqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2daqA (A:)
    gssgssgklhykqivwvklgnyrwwpaeicnprsvplniqglkhdlgdfpvfffgshdyy
    wvhqgrvfpyvegdksfaegqtsinktfkkaleeaakrfqelkasgpssg