PDB entry 2dap

View 2dap on RCSB PDB site
Description: c. glutamicum dap dehydrogenase in complex with dap
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, d-amino acid dehydrogenase, lysine biosynthesis, diaminopimelate
Deposited on 1997-12-23, released 1998-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelic acid dehydrogenase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dapa1, d2dapa2
  • Heterogens: API, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dapA (A:)
    mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd
    vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgwd
    pgmfsinrvyaaavlaehqqhtfwgpglsqghsdalrripgvqkavqytlpsedalekar
    rgeagdltgkqthkrqcfvvadaadheriendirtmpdyfvgyevevnfideatfdseht
    gmphgghvittgdtggfnhtveyilkldrnpdftassqiafgraahrmkqqgqsgaftvl
    evapyllspenlddliardv