PDB entry 2dad

View 2dad on RCSB PDB site
Description: Solution structure of the fifth crystall domain of the non-lens protein, Absent in melanoma 1
Class: oncoprotein
Keywords: crystall domain, greek key pattern, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ONCOPROTEIN
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Absent in melanoma 1 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: AIM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y4K1 (7-86)
    • cloning artifact (0-6)
    • cloning artifact (87-92)
  Domains in SCOPe 2.05: d2dada_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dadA (A:)
  gssgssgqihlfsepqfqghsqsfeettsqiddsfstkscrvsggswvvydgenftgnqy
  vleeghypclsamgcppgatfkslrfisgpssg