PDB entry 2da9

View 2da9 on RCSB PDB site
Description: Solution structure of the third SH3 domain of SH3-domain kinase binding protein 1 (Regulator of ubiquitous kinase, Ruk)
Class: apoptosis
Keywords: SH3 domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, APOPTOSIS
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-domain kinase binding protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Sh3kbp1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R550 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.05: d2da9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2da9A (A:)
gssgssgdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdnf
vkllsgpssg