PDB entry 2da6

View 2da6 on RCSB PDB site
Description: Solution structure of the homeobox domain of Hepatocyte nuclear factor 1-beta (HNF-1beta)
Class: DNA binding protein
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA binding protein
Deposited on 2005-12-13, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte nuclear factor 1-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HNF1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35680 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.08: d2da6a1, d2da6a2, d2da6a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2da6A (A:)
    gssgssgrnrfkwgpasqqilyqaydrqknpskeerealveecnraeclqrgvspskahg
    lgsnlvtevrvynwfanrrkeeafrqklamdayssnsgpssg