PDB entry 2da3

View 2da3 on RCSB PDB site
Description: Solution structure of the third homeobox domain of AT-binding transcription factor 1 (ATBF1)
Class: transcription
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-fetoprotein enhancer binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ATBF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15911 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.08: d2da3a1, d2da3a2, d2da3a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2da3A (A:)
    gssgssggtggeepqrdkrlrttitpeqleilyqkylldsnptrkmldhiahevglkkrv
    vqvwfqntrarerksgpssg