PDB entry 2da1

View 2da1 on RCSB PDB site
Description: Solution structure of the first homeobox domain of AT-binding transcription factor 1 (ATBF1)
Class: transcription
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-12-13, released 2006-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-fetoprotein enhancer binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: ATBF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15911 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.07: d2da1a1, d2da1a2, d2da1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2da1A (A:)
  gssgssgkrprtritddqlrvlrqyfdinnspseeqikemadksglpqkvikhwfrntlf
  kerqsgpssg