PDB entry 2d9u

View 2d9u on RCSB PDB site
Description: Solution structure of the Chromo domain of chromobox homolog 2 from human
Class: structural genomics, unknown function
Keywords: Chromobox homolog 2, chromo domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-12-13, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromobox protein homolog 2 (isoform 2)
  Species: Homo sapiens [TaxId:9606]
  Gene: CBX2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14781 (7-67)
    • cloning artifact (0-6)
    • cloning artifact (68-73)
  Domains in SCOPe 2.07: d2d9ua1, d2d9ua2, d2d9ua3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d9uA (A:)
  gssgssgeqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqkk
  ehekevqnsgpssg