PDB entry 2d9r

View 2d9r on RCSB PDB site
Description: Structure of Conserved Protein of Unknown Function PG0164 from Porphyromonas gingivalis [W83]
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, Porphyromonas gingivalis, hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics
Deposited on 2005-12-13, released 2006-01-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.178
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Porphyromonas gingivalis
    Gene: PG0164
    Database cross-references and differences (RAF-indexed):
    • GB AAQ65404 (Start-103)
      • modified residue (33)
      • modified residue (71)
    Domains in SCOP 1.73: d2d9ra1
  • Heterogens: CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d9rA (A:)
    mkktlpkteapssvgngsdspiefdaiirqvpdmdaayveipfdvktvygkgrvrvnatf
    dgypytgyivrmglpchilglrqdirraigkqpgdsvyvtllpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d9rA (A:)
    spiefdaiirqvpdmdaayveipfdvktvygkgrvrvnatfdgypytgyivrmglpchil
    glrqdirraigkqpgdsvyvtllpl