PDB entry 2d9j

View 2d9j on RCSB PDB site
Description: Solution structure of the RGS domain of Regulator of G-protein signaling 7
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signalling 7, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-12-09, released 2006-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signalling 7
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49802 (7-132)
      • cloning artifact (0-6)
      • see remark 999 (93)
      • cloning artifact (133-138)
    Domains in SCOPe 2.06: d2d9ja1, d2d9ja2, d2d9ja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9jA (A:)
    gssgssgsqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpik
    evpsrvqeiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsy
    prfirssayqellsgpssg