PDB entry 2d9i

View 2d9i on RCSB PDB site
Description: Solution structure of the SMR domain of NEDD4-binding protein 2
Class: apoptosis
Keywords: SMR domain, Nedd4-binding protein 2, N4BP2, BCL-3 binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-09, released 2006-06-09
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-09, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: NEDD4-binding protein 2
  Species: HOMO SAPIENS
  Gene: N4BP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86UW6 (7-89)
    • cloning artifact (0-6)
    • cloning artifact (90-95)
  Domains in SCOP 1.75: d2d9ia1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d9iA (A:)
  gssgssgqnvldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggva
  rikpavikylishsfrfseikpgclkvmlksgpssg