PDB entry 2d9i

View 2d9i on RCSB PDB site
Description: Solution structure of the SMR domain of NEDD4-binding protein 2
Class: apoptosis
Keywords: SMR domain, Nedd4-binding protein 2, N4BP2, BCL-3 binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, APOPTOSIS
Deposited on 2005-12-09, released 2006-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD4-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: N4BP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UW6 (7-89)
      • cloning artifact (0-6)
      • cloning artifact (90-95)
    Domains in SCOPe 2.08: d2d9ia1, d2d9ia2, d2d9ia3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d9iA (A:)
gssgssgqnvldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggva
rikpavikylishsfrfseikpgclkvmlksgpssg