PDB entry 2d9f

View 2d9f on RCSB PDB site
Description: Solution structure of RUH-047, an FKBP domain from human cDNA
Class: Isomerase
Keywords: FKBP, FK506 binding protein, Rapamycin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Isomerase
Deposited on 2005-12-09, released 2006-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 8 variant
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • GB BAD96558 (7-128)
    • cloning artifact (0-6)
    • cloning artifact (129-134)
  Domains in SCOPe 2.07: d2d9fa1, d2d9fa2, d2d9fa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d9fA (A:)
  gssgssgeewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepel
  vftlgdcdviqaldlsvplmdvgetamvtadskycygpqgsrspyipphaalclevtlkt
  avdrpdlemsgpssg