PDB entry 2d9c

View 2d9c on RCSB PDB site
Description: Solution structure of the first ig-like domain of signal-regulatory protein beta-1 (SIRP-beta-1)
Class: protein binding
Keywords: beta-sandwich, SIRP-beta-1, CD172b antigen, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-12-09, released 2006-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Signal-regulatory protein beta-1
  Species: Homo sapiens [TaxId:9606]
  Gene: SIRPB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00241 (7-129)
    • cloning artifact (0-6)
    • cloning artifact (130-135)
  Domains in SCOPe 2.07: d2d9ca1, d2d9ca2, d2d9ca3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d9cA (A:)
  gssgssgelqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeg
  hfprvttvseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvr
  akpsapvvsgsgpssg