PDB entry 2d9a

View 2d9a on RCSB PDB site
Description: Solution Structure of RSGI RUH-050, a myb DNA-binding domain in mouse cDNA
Class: transcription
Keywords: DNA BINDING, Structural genomics, unknown function, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-12-09, released 2006-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myb-related protein B
    Species: Mus musculus [TaxId:10090]
    Gene: NP032678
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48972 (7-53)
      • cloning artifact (0-6)
      • cloning artifact (54-59)
    Domains in SCOPe 2.08: d2d9aa1, d2d9aa2, d2d9aa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d9aA (A:)
    gssgssgkvkwtheedeqlralvrqfgqqdwkflashfpnrtdqqcqyrwlrvlsgpssg