PDB entry 2d97

View 2d97 on RCSB PDB site
Description: Structure of VIL-xylanase
Class: hydrolase
Keywords: iodo-tyrosine, VAPORIZING IODINE LABELING(VIL)
Deposited on 2005-12-09, released 2006-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.198
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Trichoderma reesei
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-188)
      • modified residue (7)
      • modified residue (71)
      • modified residue (133)
      • modified residue (177)
    Domains in SCOP 1.73: d2d97a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d97A (A:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs