PDB entry 2d8y

View 2d8y on RCSB PDB site
Description: Solution structure of the LIM domain of Epithelial protein lost in neoplasm
Class: Structural protein
Keywords: LIM domain, Epithelial protein lost in neoplasm, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: EPLIN protein
  Species: HOMO SAPIENS
  Gene: EPLIN
  Database cross-references and differences (RAF-indexed):
  • GB AAH01247 (7-84)
    • cloning artifact (0-6)
    • cloning artifact (85-90)
  Domains in SCOP 1.75: d2d8ya1, d2d8ya2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8yA (A:)
  gssgssgmkfqaparetcvecqktvypmerllanqqvfhiscfrcsycnnklslgtyasl
  hgriyckphfnqlfkskgnydegfgsgpssg